Lineage for d3rzoh_ (3rzo H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790275Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2790276Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2790316Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224866] (2 PDB entries)
  8. 2790318Domain d3rzoh_: 3rzo H: [249249]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
    automated match to d1twfh_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoh_

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d3rzoh_:

Sequence, based on SEQRES records: (download)

>d3rzoh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d3rzoh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d3rzoh_:

Click to download the PDB-style file with coordinates for d3rzoh_.
(The format of our PDB-style files is described here.)

Timeline for d3rzoh_: