Lineage for d3i9v5_ (3i9v 5:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010544Fold d.307: Nqo5-like [143242] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel
  4. 3010545Superfamily d.307.1: Nqo5-like [143243] (1 family) (S)
  5. 3010546Family d.307.1.1: Nqo5-like [143244] (2 proteins)
    Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329
  6. 3010553Protein automated matches [254685] (2 species)
    not a true protein
  7. 3010554Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries)
  8. 3010557Domain d3i9v5_: 3i9v 5: [246760]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug51
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9v5_

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (5:) NADH-quinone oxidoreductase subunit 5

SCOPe Domain Sequences for d3i9v5_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9v5_ d.307.1.1 (5:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

SCOPe Domain Coordinates for d3i9v5_:

Click to download the PDB-style file with coordinates for d3i9v5_.
(The format of our PDB-style files is described here.)

Timeline for d3i9v5_: