Lineage for d3i9v13 (3i9v 1:334-438)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708905Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 2708913Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 2708914Protein automated matches [254684] (5 species)
    not a true protein
  7. 2708936Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries)
  8. 2708939Domain d3i9v13: 3i9v 1:334-438 [246753]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug11
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9v13

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3i9v13:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9v13 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

SCOPe Domain Coordinates for d3i9v13:

Click to download the PDB-style file with coordinates for d3i9v13.
(The format of our PDB-style files is described here.)

Timeline for d3i9v13: