Lineage for d3i9va1 (3i9v A:2-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923529Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2923530Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) (S)
  5. 2923531Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 proteins)
    N-terminal part of Pfam PF01512
  6. 2923538Protein automated matches [254682] (2 species)
    not a true protein
  7. 2923539Species Thermus thermophilus HB8 [TaxId:300852] [255880] (3 PDB entries)
  8. 2923543Domain d3i9va1: 3i9v A:2-249 [246764]
    Other proteins in same PDB: d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug12
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9va1

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (A:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3i9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9va1 c.142.1.1 (A:2-249) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
gteqskgm

SCOPe Domain Coordinates for d3i9va1:

Click to download the PDB-style file with coordinates for d3i9va1.
(The format of our PDB-style files is described here.)

Timeline for d3i9va1: