SCOPe 2.08: Domain d3i9v7_: 3i9v 7:

Lineage for d3i9v7_ (3i9v 7:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.2: Nqo15-like [143572] (1 protein)
   overall structural similarity to the frataxin-like family
   automatically mapped to Pfam PF11497

6. Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143574] (5 PDB entries)
   Uniprot Q5SKZ7 3-129

8. Domain d3i9v7_: 3i9v 7: [246762]
   Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_
   automated match to d2fug71
   complexed with ca, fes, fmn, mn, sf4

Details for d3i9v7_

PDB Entry: 3i9v, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU

PDB Compounds: (7:) NADH-quinone oxidoreductase subunit 15

SCOPe Domain Sequences for d3i9v7_:

Sequence; same for both SEQRES and ATOM records:

>d3i9v7_ d.82.2.2 (7:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

Timeline for d3i9v7_:

• d3i9v7_ first appeared in SCOPe 2.04
  
• d3i9v7_ appears in SCOPe 2.07