SCOPe 2.08: Domain d3i9v2_: 3i9v 2:

Lineage for d3i9v2_ (3i9v 2:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.21: NQO2-like [142405] (2 proteins)
   complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
   automatically mapped to Pfam PF01257

6. Protein automated matches [254686] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries)

8. Domain d3i9v2_: 3i9v 2: [246754]
   Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
   automated match to d2fug21
   complexed with ca, fes, fmn, mn, sf4

Details for d3i9v2_

PDB Entry: 3i9v, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU

PDB Compounds: (2:) NADH-quinone oxidoreductase subunit 2

SCOPe Domain Sequences for d3i9v2_:

Sequence; same for both SEQRES and ATOM records:

>d3i9v2_ c.47.1.21 (2:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

Timeline for d3i9v2_:

• d3i9v2_ first appeared in SCOPe 2.04
  
• d3i9v2_ appears in SCOPe 2.07