SCOPe 2.08: Domain d3i9va2: 3i9v A:250-333

Lineage for d3i9va2 (3i9v A:250-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families)
   possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster

5. Family d.15.13.0: automated matches [254297] (1 protein)
   not a true family

6. Protein automated matches [254683] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255881] (3 PDB entries)

8. Domain d3i9va2: 3i9v A:250-333 [246765]
   Other proteins in same PDB: d3i9v11, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
   automated match to d2fug13
   complexed with ca, fes, fmn, mn, sf4

Details for d3i9va2

PDB Entry: 3i9v, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU

PDB Compounds: (A:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3i9va2:

Sequence; same for both SEQRES and ATOM records:

>d3i9va2 d.15.13.0 (A:250-333) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

Timeline for d3i9va2:

• d3i9va2 first appeared in SCOPe 2.04
  
• d3i9va2 appears in SCOPe 2.07