![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
![]() | Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) ![]() |
![]() | Family e.18.1.2: Nqo4-like [144028] (2 proteins) Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit |
![]() | Protein automated matches [254688] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255886] (3 PDB entries) |
![]() | Domain d3i9v4_: 3i9v 4: [246759] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug41 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9v4_:
Sequence, based on SEQRES records: (download)
>d3i9v4_ e.18.1.2 (4:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprm dylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltp ffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideye alfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvp lgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeavi yhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyac kgeqvpdmvaiiasldpvmgdvdr
>d3i9v4_ e.18.1.2 (4:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd mvaiiasldpvmgdvdr
Timeline for d3i9v4_: