Lineage for d3i9vg_ (3i9v G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949437Protein automated matches [254689] (2 species)
    not a true protein
  7. 2949441Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries)
  8. 2949445Domain d3i9vg_: 3i9v G: [246775]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vh_
    automated match to d2fug91
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9vg_

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (G:) NADH-quinone oxidoreductase subunit 9

SCOPe Domain Sequences for d3i9vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9vg_ d.58.1.5 (G:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

SCOPe Domain Coordinates for d3i9vg_:

Click to download the PDB-style file with coordinates for d3i9vg_.
(The format of our PDB-style files is described here.)

Timeline for d3i9vg_: