Lineage for d3i9v31 (3i9v 3:1-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934321Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries)
  8. 2934324Domain d3i9v31: 3i9v 3:1-95 [246755]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug33
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9v31

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3i9v31:

Sequence, based on SEQRES records: (download)

>d3i9v31 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records): (download)

>d3i9v31 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
klaascvtavadgmvvdt

SCOPe Domain Coordinates for d3i9v31:

Click to download the PDB-style file with coordinates for d3i9v31.
(The format of our PDB-style files is described here.)

Timeline for d3i9v31: