Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
Domain d3ptfb1: 3ptf B:1-147 [183969] Other proteins in same PDB: d3ptfa2, d3ptfb2, d3ptfc_, d3ptfd1, d3ptfd2 automated match to d1z2ua1 |
PDB Entry: 3ptf (more details), 2.7 Å
SCOPe Domain Sequences for d3ptfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ptfb1 d.20.1.1 (B:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]} malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv pdiaqiyksdkekynrharewtqkyam
Timeline for d3ptfb1: