Lineage for d3ptfb1 (3ptf B:1-147)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546288Protein automated matches [190124] (13 species)
    not a true protein
  7. 2546306Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)
  8. 2546362Domain d3ptfb1: 3ptf B:1-147 [183969]
    Other proteins in same PDB: d3ptfa2, d3ptfb2, d3ptfc_, d3ptfd1, d3ptfd2
    automated match to d1z2ua1

Details for d3ptfb1

PDB Entry: 3ptf (more details), 2.7 Å

PDB Description: X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d3ptfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptfb1 d.20.1.1 (B:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkyam

SCOPe Domain Coordinates for d3ptfb1:

Click to download the PDB-style file with coordinates for d3ptfb1.
(The format of our PDB-style files is described here.)

Timeline for d3ptfb1: