SCOPe 2.08: Domain d3ptfa1: 3ptf A:1-147

Lineage for d3ptfa1 (3ptf A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d3ptfa1: 3ptf A:1-147 [183968]
   Other proteins in same PDB: d3ptfa2, d3ptfb2, d3ptfc_, d3ptfd1, d3ptfd2
   automated match to d1z2ua1

Details for d3ptfa1

PDB Entry: 3ptf, 2.7 Å

PDB Description: X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d3ptfa1:

Sequence; same for both SEQRES and ATOM records:

>d3ptfa1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkyam

Timeline for d3ptfa1:

• d3ptfa1 first appeared in SCOPe 2.01, called d3ptfa_
  
• d3ptfa1 appears in SCOPe 2.07