SCOPe 2.01: Domain d3ptfb_: 3ptf B:

Lineage for d3ptfb_ (3ptf B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (14 PDB entries)

8. Domain d3ptfb_: 3ptf B: [183969]
   Other proteins in same PDB: d3ptfc_, d3ptfd_
   automated match to d1z2ua1

Details for d3ptfb_

PDB Entry: 3ptf, 2.7 Å

PDB Description: X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d3ptfb_:

Sequence; same for both SEQRES and ATOM records:

>d3ptfb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmlemalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvh
fptdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnp
ddplvpdiaqiyksdkekynrharewtqkyam

Timeline for d3ptfb_:

• d3ptfb_ is new in SCOPe 2.01-stable
  
• d3ptfb_ appears in SCOPe 2.02
  
• d3ptfb_ appears in the current release, SCOPe 2.08, called d3ptfb1