Lineage for d1z2ua1 (1z2u A:1-147)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) Species Caenorhabditis elegans, E2 2 [TaxId:6239] [143060] (1 PDB entry)
Uniprot P35129 1-147
Domain d1z2ua1: 1z2u A:1-147 [124389]
Other proteins in same PDB: d1z2ua2
complexed with bu3, cl, na, unx
Details for d1z2ua1
PDB Entry: 1z2u (more details), 1.1 Å
PDB Description: the 1.1a crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from caenorhabditis elegans: functional and evolutionary significance
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 2SCOPe Domain Sequences for d1z2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]}
malkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrerynqlarewtqkyam
SCOPe Domain Coordinates for d1z2ua1:
Click to download the PDB-style file with coordinates for d1z2ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z2ua1:
- d1z2ua1 first appeared in SCOP 1.73
- d1z2ua1 appears in SCOPe 2.07
View in 3D
