Lineage for d1hnxt_ (1hnx T:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1840Fold a.7: Spectrin repeat-like [46965] (6 superfamilies)
  4. 1893Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 1894Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1895Protein Ribosomal protein S20 [46994] (1 species)
  7. 1896Species Thermus thermophilus [TaxId:274] [46995] (6 PDB entries)
  8. 1902Domain d1hnxt_: 1hnx T: [16342]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxv_

Details for d1hnxt_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1hnxt_:

Click to download the PDB-style file with coordinates for d1hnxt_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxt_: