Lineage for d1hnxk_ (1hnx K:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.4: Translational machinery components [53137] (2 families) 
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) 
Protein Ribosomal protein S11 [53141] (1 species) Species Thermus thermophilus [TaxId:274] [53142] (6 PDB entries) 
Domain d1hnxk_: 1hnx K: [33737]
Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
Details for d1hnxk_
PDB Entry: 1hnx (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
SCOP Domain Sequences for d1hnxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
SCOP Domain Coordinates for d1hnxk_:
Click to download the PDB-style file with coordinates for d1hnxk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnxk_:
- d1hnxk_ appears in SCOP 1.57
- d1hnxk_ appears in the current release, SCOPe 2.08
View in 3D
