| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
| Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries) |
| Domain d1hnxc1: 1hnx C:2-106 [38835] Other proteins in same PDB: d1hnxb_, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1hnxc1: