Lineage for d1hnxi_ (1hnx I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.1: Translational machinery components [54212] (3 proteins) 
Protein Ribosomal protein S9 [54218] (1 species) Species Thermus thermophilus [TaxId:274] [54219] (6 PDB entries) 
Domain d1hnxi_: 1hnx I: [37563]
Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
Details for d1hnxi_
PDB Entry: 1hnx (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
SCOP Domain Sequences for d1hnxi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr
SCOP Domain Coordinates for d1hnxi_:
Click to download the PDB-style file with coordinates for d1hnxi_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnxi_:
- d1hnxi_ appears in SCOP 1.57
- d1hnxi_ appears in the current release, SCOPe 2.08
View in 3D
