Lineage for d1hnxh_ (1hnx H:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36073Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 36074Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 36075Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 36076Protein Ribosomal protein S8 [56049] (2 species)
  7. 36080Species Thermus thermophilus [TaxId:274] [56051] (7 PDB entries)
  8. 36088Domain d1hnxh_: 1hnx H: [41472]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxh_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1hnxh_:

Click to download the PDB-style file with coordinates for d1hnxh_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxh_: