Lineage for d1hnxf_ (1hnx F:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (1 species) Species Thermus thermophilus [TaxId:274] [54998] (12 PDB entries) 
Domain d1hnxf_: 1hnx F: [39320]
Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
Details for d1hnxf_
PDB Entry: 1hnx (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
SCOP Domain Sequences for d1hnxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
SCOP Domain Coordinates for d1hnxf_:
Click to download the PDB-style file with coordinates for d1hnxf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnxf_:
- d1hnxf_ appears in SCOP 1.57
- d1hnxf_ appears in the current release, SCOPe 2.08
View in 3D
