![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
![]() | Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
![]() | Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
![]() | Domain d3ccli1: 3ccl I:66-129 [156315] Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1 automatically matched to d1s72i_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccl (more details), 2.9 Å
SCOPe Domain Sequences for d3ccli1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccli1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]} gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg tcts
Timeline for d3ccli1: