Lineage for d3ccls1 (3ccl S:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929544Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2929545Protein Ribosomal protein L23 [54191] (4 species)
  7. 2929584Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 2929627Domain d3ccls1: 3ccl S:1-81 [156324]
    Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1
    automatically matched to d1jj2r_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccls1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3ccls1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccls1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d3ccls1:

Click to download the PDB-style file with coordinates for d3ccls1.
(The format of our PDB-style files is described here.)

Timeline for d3ccls1: