Lineage for d3cclt1 (3ccl T:1-119)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3044006Domain d3cclt1: 3ccl T:1-119 [156325]
    Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1
    automatically matched to d1w2bs_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cclt1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d3cclt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cclt1 i.1.1.2 (T:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d3cclt1:

Click to download the PDB-style file with coordinates for d3cclt1.
(The format of our PDB-style files is described here.)

Timeline for d3cclt1: