Lineage for d3cclh1 (3ccl H:4-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945283Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2945284Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2945285Protein Ribosomal protein L10e [54688] (2 species)
  7. 2945286Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2945329Domain d3cclh1: 3ccl H:4-166 [156314]
    Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1
    automatically matched to d1s72h_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cclh1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d3cclh1:

Sequence, based on SEQRES records: (download)

>d3cclh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d3cclh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOPe Domain Coordinates for d3cclh1:

Click to download the PDB-style file with coordinates for d3cclh1.
(The format of our PDB-style files is described here.)

Timeline for d3cclh1: