| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
| Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
| Protein Ribosomal protein L10e [54688] (2 species) |
| Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries) Uniprot P60617 |
| Domain d3cclh1: 3ccl H:4-166 [156314] Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1 automatically matched to d1s72h_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccl (more details), 2.9 Å
SCOPe Domain Sequences for d3cclh1:
Sequence, based on SEQRES records: (download)
>d3cclh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri
>d3cclh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri
Timeline for d3cclh1: