Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cclv1: 3ccl V:1-65 [156327] Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1 automatically matched to d1w2bu_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccl (more details), 2.9 Å
SCOPe Domain Sequences for d3cclv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cclv1 i.1.1.2 (V:1-65) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d3cclv1: