Lineage for d3cclr1 (3ccl R:1-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948758Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2948801Domain d3cclr1: 3ccl R:1-150 [156323]
    Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1
    automatically matched to d1ffko_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cclr1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d3cclr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cclr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d3cclr1:

Click to download the PDB-style file with coordinates for d3cclr1.
(The format of our PDB-style files is described here.)

Timeline for d3cclr1: