SCOPe 2.08: Domain d3ccl11: 3ccl 1:1-56

Lineage for d3ccl11 (3ccl 1:1-56)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d3ccl11: 3ccl 1:1-56 [156308]
   Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1
   automatically matched to d1w2bz_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccl11

PDB Entry: 3ccl, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.

PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3ccl11:

Sequence; same for both SEQRES and ATOM records:

>d3ccl11 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d3ccl11:

• d3ccl11 first appeared in SCOP 1.75
  
• d3ccl11 appears in SCOPe 2.07