Lineage for d2j0151 (2j01 5:2-60)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2588084Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2588236Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2588237Protein Ribosomal protein L32p [144201] (3 species)
  7. 2588273Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 2588275Domain d2j0151: 2j01 5:2-60 [145560]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex
    protein/RNA complex

Details for d2j0151

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2j0151:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2j0151:

Click to download the PDB-style file with coordinates for d2j0151.
(The format of our PDB-style files is described here.)

Timeline for d2j0151: