SCOPe 2.08: Domain d2j0151: 2j01 5:2-60

Lineage for d2j0151 (2j01 5:2-60)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
   Uniprot P80339 1-59

8. Domain d2j0151: 2j01 5:2-60 [145560]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   Representative structure
   protein/RNA complex
   protein/RNA complex

Details for d2j0151

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2j0151:

Sequence; same for both SEQRES and ATOM records:

>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

Timeline for d2j0151:

• d2j0151 first appeared in SCOP 1.75
  
• d2j0151 appears in SCOPe 2.07