Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries) Uniprot Q72I19 11-81! Uniprot Q72I19 82-170 |
Domain d2j01h2: 2j01 H:83-171 [145570] Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 Representative structure protein/RNA complex protein/RNA complex |
PDB Entry: 2j01 (more details), 2.8 Å
SCOPe Domain Sequences for d2j01h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg qvaanirairkpsayhekgiyyagepvrl
Timeline for d2j01h2:
View in 3D Domains from other chains: (mouse over for more information) d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 |