Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries) |
Domain d2j01x1: 2j01 X:3-95 [145580] Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01y1, d2j01z1 protein/RNA complex protein/RNA complex |
PDB Entry: 2j01 (more details), 2.8 Å
SCOPe Domain Sequences for d2j01x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j01x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk kkrlgrylgkrpdrkkaivqvapgqkiealegl
Timeline for d2j01x1:
View in 3D Domains from other chains: (mouse over for more information) d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01y1, d2j01z1 |