SCOPe 2.08: Domain d2j01v1: 2j01 V:1-101

Lineage for d2j01v1 (2j01 V:1-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
   Uniprot P60492 1-101

8. Domain d2j01v1: 2j01 V:1-101 [145578]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   protein/RNA complex
   protein/RNA complex

Details for d2j01v1

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (V:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2j01v1:

Sequence; same for both SEQRES and ATOM records:

>d2j01v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

Timeline for d2j01v1:

• d2j01v1 first appeared in SCOP 1.75
  
• d2j01v1 appears in SCOPe 2.07