Lineage for d2j0131 (2j01 3:1-60)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956419Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2956420Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2956421Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2956464Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2956502Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 2956506Domain d2j0131: 2j01 3:1-60 [145558]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    protein/RNA complex
    protein/RNA complex

Details for d2j0131

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (3:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2j0131:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0131 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2j0131:

Click to download the PDB-style file with coordinates for d2j0131.
(The format of our PDB-style files is described here.)

Timeline for d2j0131: