Lineage for d2j01r1 (2j01 R:14-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005595Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 3005596Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 3005597Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 3005598Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 3005636Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 3005647Domain d2j01r1: 2j01 R:14-118 [145574]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    protein/RNA complex
    protein/RNA complex

Details for d2j01r1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (R:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2j01r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01r1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2j01r1:

Click to download the PDB-style file with coordinates for d2j01r1.
(The format of our PDB-style files is described here.)

Timeline for d2j01r1: