SCOPe 2.08: Domain d2j01d2: 2j01 D:2-126

Lineage for d2j01d2 (2j01 D:2-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Thermus thermophilus [TaxId:274] [159084] (6 PDB entries)
   Uniprot Q72I07 1-125

8. Domain d2j01d2: 2j01 D:2-126 [145565]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   Representative structure
   protein/RNA complex
   protein/RNA complex
   missing some secondary structures that made up less than one-third of the common domain

Details for d2j01d2

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2j01d2:

Sequence; same for both SEQRES and ATOM records:

>d2j01d2 b.40.4.5 (D:2-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
dapiq

Timeline for d2j01d2:

• d2j01d2 first appeared in SCOP 1.75
  
• d2j01d2 appears in SCOPe 2.07