Lineage for d2cw0f1 (2cw0 F:258-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695833Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 2695845Protein Sigma70 [88661] (2 species)
  7. 2695849Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries)
    Uniprot Q9WX78
  8. 2695868Domain d2cw0f1: 2cw0 F:258-318 [130905]
    Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p2, d2cw0p3
    automatically matched to d1iw7f1
    complexed with mg, zn

Details for d2cw0f1

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2cw0f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw0f1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d2cw0f1:

Click to download the PDB-style file with coordinates for d2cw0f1.
(The format of our PDB-style files is described here.)

Timeline for d2cw0f1: