Lineage for d2cw0m1 (2cw0 M:1-1119)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 protein domains)
  6. 2574291Protein RNA-polymerase beta [64488] (2 species)
  7. 2574297Species Thermus thermophilus [TaxId:274] [75609] (10 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 2574311Domain d2cw0m1: 2cw0 M:1-1119 [130912]
    Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3
    automatically matched to d1iw7c_
    complexed with mg, zn

Details for d2cw0m1

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: Crystal structure of Thermus thermophilus RNA polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (M:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d2cw0m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw0m1 e.29.1.1 (M:1-1119) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d2cw0m1:

Click to download the PDB-style file with coordinates for d2cw0m1.
(The format of our PDB-style files is described here.)

Timeline for d2cw0m1: