Lineage for d2cw0k2 (2cw0 K:50-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3004954Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 3004969Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 3005026Domain d2cw0k2: 2cw0 K:50-172 [130909]
    Other proteins in same PDB: d2cw0a1, d2cw0b1, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0l1, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3
    automatically matched to d1iw7a2
    complexed with mg, zn

Details for d2cw0k2

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2cw0k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw0k2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2cw0k2:

Click to download the PDB-style file with coordinates for d2cw0k2.
(The format of our PDB-style files is described here.)

Timeline for d2cw0k2: