![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
![]() | Protein RNA polymerase alpha [55259] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
![]() | Domain d2cw0l1: 2cw0 L:1-49,L:173-229 [130910] Other proteins in same PDB: d2cw0a2, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k2, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3 automatically matched to d1iw7a1 complexed with mg, zn |
PDB Entry: 2cw0 (more details), 3.3 Å
SCOPe Domain Sequences for d2cw0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw0l1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d2cw0l1: