SCOPe 2.08: Domain d2cw0a1: 2cw0 A:1-49,A:173-229

Lineage for d2cw0a1 (2cw0 A:1-49,A:173-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2cw0a1: 2cw0 A:1-49,A:173-229 [130898]
   Other proteins in same PDB: d2cw0a2, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k2, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3
   automatically matched to d1iw7a1
   complexed with mg, zn

Details for d2cw0a1

PDB Entry: 2cw0, 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution

PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2cw0a1:

Sequence; same for both SEQRES and ATOM records:

>d2cw0a1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2cw0a1:

• d2cw0a1 first appeared in SCOP 1.73
  
• d2cw0a1 appears in SCOPe 2.07