Class a: All alpha proteins [46456] (290 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
Protein RNA polymerase omega subunit [63564] (3 species) |
Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
Domain d2cw0o1: 2cw0 O:2-96 [130914] Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0p1, d2cw0p2, d2cw0p3 automatically matched to d1iw7e_ complexed with mg, zn |
PDB Entry: 2cw0 (more details), 3.3 Å
SCOPe Domain Sequences for d2cw0o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw0o1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d2cw0o1: