SCOP 1.73: Domain d2b66h1: 2b66 H:7-81

Lineage for d2b66h1 (2b66 H:7-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)

8. Domain d2b66h1: 2b66 H:7-81 [127957]
   Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
   automatically matched to d1rl6a1

Details for d2b66h1

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d2b66h1:

Sequence; same for both SEQRES and ATOM records:

>d2b66h1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg

Timeline for d2b66h1:

• d2b66h1 is new in SCOP 1.73
  
• d2b66h1 appears in SCOP 1.75
  
• d2b66h1 appears in the current release, SCOPe 2.08