| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
| Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
| Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
| Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries) |
| Domain d2b66h1: 2b66 H:7-81 [127957] Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1 automatically matched to d1rl6a1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOP Domain Sequences for d2b66h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66h1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg
Timeline for d2b66h1: