![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (2 species) |
![]() | Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries) |
![]() | Domain d2b66w1: 2b66 W:2-110 [127967] Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66x1, d2b66y1 automatically matched to d1bxea_ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOP Domain Sequences for d2b66w1:
Sequence, based on SEQRES records: (download)
>d2b66w1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
>d2b66w1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d2b66w1: