SCOP 1.73: Domain d2b66k1: 2b66 K:71-140

Lineage for d2b66k1 (2b66 K:71-140)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [46910] (5 PDB entries)

8. Domain d2b66k1: 2b66 K:71-140 [127961]
   Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
   automatically matched to d1mmsa1

Details for d2b66k1

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (K:) 50S ribosomal protein L11

SCOP Domain Sequences for d2b66k1:

Sequence; same for both SEQRES and ATOM records:

>d2b66k1 a.4.7.1 (K:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d2b66k1:

• d2b66k1 is new in SCOP 1.73
  
• d2b66k1 appears in SCOP 1.75
  
• d2b66k1 appears in the current release, SCOPe 2.08