SCOP 1.73: Domain d2b66i2: 2b66 I:1-55

Lineage for d2b66i2 (2b66 I:1-55)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.100: L9 N-domain-like [55657] (1 superfamily)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (7 PDB entries)

8. Domain d2b66i2: 2b66 I:1-55 [127960]
   Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
   automatically matched to d1cqua_

Details for d2b66i2

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2b66i2:

Sequence; same for both SEQRES and ATOM records:

>d2b66i2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

Timeline for d2b66i2:

• d2b66i2 is new in SCOP 1.73
  
• d2b66i2 appears in SCOP 1.75
  
• d2b66i2 appears in the current release, SCOPe 2.08