Lineage for d2b6621 (2b66 2:1-65)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633322Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 633323Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 633324Protein Ribosomal protein L29 (L29p) [46563] (4 species)
  7. 633325Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
  8. 633367Domain d2b6621: 2b66 2:1-65 [127954]
    Other proteins in same PDB: d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
    automatically matched to d1ffks_

Details for d2b6621

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (2:) 50S ribosomal protein L29

SCOP Domain Sequences for d2b6621:

Sequence, based on SEQRES records: (download)

>d2b6621 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records): (download)

>d2b6621 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

SCOP Domain Coordinates for d2b6621:

Click to download the PDB-style file with coordinates for d2b6621.
(The format of our PDB-style files is described here.)

Timeline for d2b6621: