SCOP 1.73: Domain d2b66i1: 2b66 I:56-149

Lineage for d2b66i1 (2b66 I:56-149)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries)

8. Domain d2b66i1: 2b66 I:56-149 [127959]
   Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
   automatically matched to d1div_1

Details for d2b66i1

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2b66i1:

Sequence, based on SEQRES records:

>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records):

>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

Timeline for d2b66i1:

• d2b66i1 is new in SCOP 1.73
  
• d2b66i1 appears in SCOP 1.75
  
• d2b66i1 appears in the current release, SCOPe 2.08