SCOP 1.73: Domain d2b66y1: 2b66 Y:1-113

Lineage for d2b66y1 (2b66 Y:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)

8. Domain d2b66y1: 2b66 Y:1-113 [127969]
   Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1
   automatically matched to d1ffkq_

Details for d2b66y1

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (Y:) 50S ribosomal protein 24

SCOP Domain Sequences for d2b66y1:

Sequence, based on SEQRES records:

>d2b66y1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records):

>d2b66y1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Timeline for d2b66y1:

• d2b66y1 is new in SCOP 1.73
  
• d2b66y1 appears in SCOP 1.75
  
• d2b66y1 appears in the current release, SCOPe 2.08