Class b: All beta proteins [48724] (165 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50196] (5 PDB entries) |
Domain d2b66o1: 2b66 O:1-122 [127964] Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1 automatically matched to d1whi__ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOP Domain Sequences for d2b66o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape vi
Timeline for d2b66o1: